Adrenomedullin
An endogenous 52-amino-acid peptide hormone involved in vascular tone, endothelial integrity, lymphatic biology and inflammatory responses.
- Human evidencen/a
- Animal evidencen/a
- Mechanisticn/a
- Safety knowledgen/a
- Editorial confidence4/5
Evidence Snapshot
- Overall
- 2/5Emerging / preliminary
- Human
- 2/5Some human clinical evidence
- Animal
- 0/5None identified
- In-vitro
- 0/5None identified
- Safety
- 2/5Partially characterised safety
Scientific identity
- Molecular formula
- C203H331N63O60S3
- Molecular weight
- 6028.7 Da
- Sequence
- YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
- Peptide family
- Calcitonin peptide family
- Entity class
- Endogenous peptide hormone
- Alternative names
- ADMAM
Discovered in 1993 from human pheochromocytoma tissue as a potent vasodilatory peptide.
Proposed Mechanisms
- not-yet-documentedpending-editorial-review
- Nitric oxide / blood flow →strong
- Angiogenesis →strong
- Inflammation modulation →strong
Reported / Studied Uses
- Metabolic Health / Insulin ResistanceEvidence · insufficient
Human Evidence
Small infusion studies demonstrate haemodynamic and endocrine effects in humans. Biomarker studies link elevated circulating adrenomedullin with congestion and severity in heart failure and severe inflammation.
Animal Evidence
Extensive animal and laboratory evidence supports vasodilation, endothelial-barrier regulation, angiogenesis and organ-protective effects.
Safety & Unknowns
Regulatory Status
| Country | Status | Notes |
|---|
Community Observations
References
- No verified references linked yet. Editors will add primary sources.
Full Disclaimer
This page is for educational information only. It does not constitute medical advice, diagnosis, treatment, dosing guidance, or a recommendation to use any peptide, medicine or research chemical. Many peptides discussed on Atlas are not approved for human use in most jurisdictions and may have limited or unknown long-term safety data.
Community observations shown on this page are anonymised, moderated and observational only. They do not establish safety or effectiveness.
Always consult a qualified healthcare professional before making decisions about your health. See medical disclaimer and methodology.
Explore further
from the knowledge graph- Differing thresholds for modulatory effects of adrenomedullin infusion on haemodynamic and hormonal responses to angiotensin II and adrenocorticotrophic hormone in healthy volunteers2001 · placebo_controlled_crossover_study
- Current perspective on a peptide hormone with significant therapeutic potential2020 · narrative_review